Lineage for d1za6f2 (1za6 F:116-218)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655115Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655312Domain d1za6f2: 1za6 F:116-218 [124813]
    Other proteins in same PDB: d1za6b1, d1za6b3, d1za6d1, d1za6d3, d1za6f1, d1za6f3, d1za6h1, d1za6h3
    automatically matched to d1ngzb2

Details for d1za6f2

PDB Entry: 1za6 (more details), 2.8 Å

PDB Description: The structure of an antitumor CH2-domain-deleted humanized antibody
PDB Compounds: (F:) IGG Heavy chain

SCOP Domain Sequences for d1za6f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1za6f2 b.1.1.2 (F:116-218) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d1za6f2:

Click to download the PDB-style file with coordinates for d1za6f2.
(The format of our PDB-style files is described here.)

Timeline for d1za6f2: