Lineage for d1za6d1 (1za6 D:2-115)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652563Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 652729Domain d1za6d1: 1za6 D:2-115 [124809]
    Other proteins in same PDB: d1za6b2, d1za6b3, d1za6d2, d1za6d3, d1za6f2, d1za6f3, d1za6h2, d1za6h3
    automatically matched to d1igyb1

Details for d1za6d1

PDB Entry: 1za6 (more details), 2.8 Å

PDB Description: The structure of an antitumor CH2-domain-deleted humanized antibody
PDB Compounds: (D:) IGG Heavy chain

SCOP Domain Sequences for d1za6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1za6d1 b.1.1.1 (D:2-115) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
vqlvqsgaevvkpgasvkisckasgytftdhaihwvkqnpgqrlewigyfspgnddfkyn
erfkgkatltadtsastayvelsslrsedtavyfctrslnmaywgqgtlvtvss

SCOP Domain Coordinates for d1za6d1:

Click to download the PDB-style file with coordinates for d1za6d1.
(The format of our PDB-style files is described here.)

Timeline for d1za6d1: