Lineage for d1za5a1 (1za5 A:1-82)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979785Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1979786Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 protein domains)
  6. 1979814Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)
  7. 1979819Species Escherichia coli [TaxId:562] [46614] (5 PDB entries)
  8. 1979830Domain d1za5a1: 1za5 A:1-82 [124802]
    Other proteins in same PDB: d1za5a2, d1za5b2
    automated match to d1isca1
    complexed with fe, trs

Details for d1za5a1

PDB Entry: 1za5 (more details), 1.8 Å

PDB Description: q69h-fesod
PDB Compounds: (A:) superoxide dismutase [fe]

SCOPe Domain Sequences for d1za5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1za5a1 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]}
sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
ggvfnnaahvwnhtfywnclap

SCOPe Domain Coordinates for d1za5a1:

Click to download the PDB-style file with coordinates for d1za5a1.
(The format of our PDB-style files is described here.)

Timeline for d1za5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1za5a2