![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
![]() | Superfamily g.24.1: TNF receptor-like [57586] (3 families) ![]() |
![]() | Family g.24.1.1: TNF receptor-like [57587] (13 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
![]() | Domain d1za3s2: 1za3 S:62-101 [124799] Other proteins in same PDB: d1za3a1, d1za3a2, d1za3b1, d1za3b2, d1za3h1, d1za3h2, d1za3l1, d1za3l2, d1za3r1, d1za3r3, d1za3s1, d1za3s3 automatically matched to d1d0gr2 |
PDB Entry: 1za3 (more details), 3.35 Å
SCOPe Domain Sequences for d1za3s2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1za3s2 g.24.1.1 (S:62-101) Death receptor-5 (dr5) fragment, middle domain {Human (Homo sapiens) [TaxId: 9606]} rctrcdsgevelspctttrntvcqceegtfreedspemcr
Timeline for d1za3s2: