Lineage for d1za3l1 (1za3 L:1-106)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 930396Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 931221Species Norway rat (Rattus norvegicus) [TaxId:10116] [88532] (9 PDB entries)
  8. 931234Domain d1za3l1: 1za3 L:1-106 [124793]
    Other proteins in same PDB: d1za3a2, d1za3b1, d1za3b2, d1za3h1, d1za3h2, d1za3l2, d1za3r1, d1za3r2, d1za3r3, d1za3s1, d1za3s2, d1za3s3
    automatically matched to d1c5da1

Details for d1za3l1

PDB Entry: 1za3 (more details), 3.35 Å

PDB Description: The crystal structure of the YSd1 Fab bound to DR5
PDB Compounds: (L:) Fab-YSd1 light chain

SCOPe Domain Sequences for d1za3l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1za3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliyaasylysgvps
rfsgsgsgtdftltisslqpedfatyycqsssspytfgqgtkveik

SCOPe Domain Coordinates for d1za3l1:

Click to download the PDB-style file with coordinates for d1za3l1.
(The format of our PDB-style files is described here.)

Timeline for d1za3l1: