SCOPe 2.01: Domain d1za3h2: 1za3 H:114-214

Lineage for d1za3h2 (1za3 H:114-214)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1za3h2: 1za3 H:114-214 [124792]
   Other proteins in same PDB: d1za3a1, d1za3a2, d1za3b1, d1za3h1, d1za3l1, d1za3l2, d1za3r1, d1za3r2, d1za3r3, d1za3s1, d1za3s2, d1za3s3
   automatically matched to d1ngzb2

Details for d1za3h2

PDB Entry: 1za3, 3.35 Å

PDB Description: The crystal structure of the YSd1 Fab bound to DR5

PDB Compounds: (H:) Fab-YSd1 heavy chain

SCOPe Domain Sequences for d1za3h2:

Sequence, based on SEQRES records:

>d1za3h2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records):

>d1za3h2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1za3h2:

• d1za3h2 first appeared in SCOP 1.73
  
• d1za3h2 appears in SCOP 1.75
  
• d1za3h2 appears in SCOPe 2.02
  
• d1za3h2 appears in the current release, SCOPe 2.08