Lineage for d1za3b1 (1za3 B:1-113)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287449Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 1287487Species Llama (Lama glama) [TaxId:9844] [88565] (8 PDB entries)
  8. 1287494Domain d1za3b1: 1za3 B:1-113 [124789]
    Other proteins in same PDB: d1za3a1, d1za3a2, d1za3b2, d1za3h2, d1za3l1, d1za3l2, d1za3r1, d1za3r2, d1za3r3, d1za3s1, d1za3s2, d1za3s3
    automatically matched to d1i3va_

Details for d1za3b1

PDB Entry: 1za3 (more details), 3.35 Å

PDB Description: The crystal structure of the YSd1 Fab bound to DR5
PDB Compounds: (B:) Fab-YSd1 heavy chain

SCOPe Domain Sequences for d1za3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1za3b1 b.1.1.1 (B:1-113) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
evqlvesggglvqpggslrlscaasgfsiysysihwvrqapgkglewvasispysgytsy
adsvkgrftisadtskntaylqmnslraedtavyycsryssyysyyyssssysyamdywg
qgtlvtvss

SCOPe Domain Coordinates for d1za3b1:

Click to download the PDB-style file with coordinates for d1za3b1.
(The format of our PDB-style files is described here.)

Timeline for d1za3b1: