Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88568] (6 PDB entries) |
Domain d1za3a2: 1za3 A:107-213 [124788] Other proteins in same PDB: d1za3a1, d1za3b1, d1za3b2, d1za3h1, d1za3h2, d1za3l1, d1za3r1, d1za3r2, d1za3r3, d1za3s1, d1za3s2, d1za3s3 automatically matched to d1c5da2 |
PDB Entry: 1za3 (more details), 3.35 Å
SCOPe Domain Sequences for d1za3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1za3a2 b.1.1.2 (A:107-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1za3a2: