SCOPe 2.08: Domain d1za2c1: 1za2 C:1-150

Lineage for d1za2c1 (1za2 C:1-150)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)

7. Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
   Uniprot P00479

8. Domain d1za2c1: 1za2 C:1-150 [124785]
   Other proteins in same PDB: d1za2b1, d1za2b2, d1za2d1, d1za2d2
   automated match to d3csua1
   complexed with cp, ctp, na, zn

Details for d1za2c1

PDB Entry: 1za2, 2.5 Å

PDB Description: Structure of wild-type E. coli Aspartate Transcarbamoylase in the presence of CTP, carbamoyl phosphate at 2.50 A resolution

PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d1za2c1:

Sequence; same for both SEQRES and ATOM records:

>d1za2c1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d1za2c1:

• d1za2c1 first appeared in SCOP 1.73
  
• d1za2c1 appears in SCOPe 2.07