Lineage for d1za0a1 (1za0 A:8-274)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990175Protein Possible acyl-[acyl-carrier protein] desaturase [140442] (1 species)
  7. 1990176Species Mycobacterium tuberculosis [TaxId:1773] [140443] (1 PDB entry)
    Uniprot O53442 8-274
  8. 1990177Domain d1za0a1: 1za0 A:8-274 [124774]
    complexed with edo, mn

Details for d1za0a1

PDB Entry: 1za0 (more details), 2 Å

PDB Description: X-ray structure of putative acyl-ACP desaturase DesA2 from Mycobacterium tuberculosis H37Rv
PDB Compounds: (A:) possible acyl-[acyl-carrier protein] desaturase desa2 (acyl-[acp] desaturase) (stearoyl-acp desaturase)

SCOPe Domain Sequences for d1za0a1:

Sequence, based on SEQRES records: (download)

>d1za0a1 a.25.1.2 (A:8-274) Possible acyl-[acyl-carrier protein] desaturase {Mycobacterium tuberculosis [TaxId: 1773]}
daltlelepvveanmtrhldtediwfahdyvpfdqgenfaflggrdwdpsqstlprtitd
aceillilkdnlaghhrelvehfiledwwgrwlgrwtaeehlhaialreylvvtrevdpv
anedvrvqhvmkgyraekytqvetlvymafyercgavfcrnlaaqieepilaglidriar
devrheeffanlvthcldytrdetiaaiaaraadldvlgadieayrdklqnvadagifgk
pqlrqlisdritawglagepslkqfvt

Sequence, based on observed residues (ATOM records): (download)

>d1za0a1 a.25.1.2 (A:8-274) Possible acyl-[acyl-carrier protein] desaturase {Mycobacterium tuberculosis [TaxId: 1773]}
daltlelepvveanmtrhldtediwfahdyvpfdqgenfaflggrdwdpsqstlprtitd
aceillilkdndwwgrwlgrwtaeehlhaialreylvvtrevdpvanedvrvkytqvetl
vymafyercgavfcrnlaaqieepilaglidriardevrheeffanlvthcldytrdeti
aaiaaraadldvlgadieayrdklqnvadagifgkpqlrqlisdritawglagepslkqf
vt

SCOPe Domain Coordinates for d1za0a1:

Click to download the PDB-style file with coordinates for d1za0a1.
(The format of our PDB-style files is described here.)

Timeline for d1za0a1: