Lineage for d1z9wa_ (1z9w A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966432Family d.96.1.3: DHN aldolase/epimerase [55628] (3 proteins)
    beta-sheets of four subunits form a barrel, closed: n=16, S=16
    automatically mapped to Pfam PF02152
  6. 2966433Protein 7,8-dihydroneopterin aldolase [55629] (4 species)
  7. 2966437Species Mycobacterium tuberculosis [TaxId:1773] [103143] (2 PDB entries)
    Uniprot O06275 2-115
  8. 2966446Domain d1z9wa_: 1z9w A: [124772]
    automated match to d1nbua_

Details for d1z9wa_

PDB Entry: 1z9w (more details), 2.5 Å

PDB Description: Tetrameric structure of apo-7,8-Dihydroneopterin Aldolase from Mycobacterium tuberculosis
PDB Compounds: (A:) dihydroneopterin aldolase

SCOPe Domain Sequences for d1z9wa_:

Sequence, based on SEQRES records: (download)

>d1z9wa_ d.96.1.3 (A:) 7,8-dihydroneopterin aldolase {Mycobacterium tuberculosis [TaxId: 1773]}
adrielrgltvhgrhgvydhervagqrfvidvtvwidlaeaansddladtydyvrlasra
aeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsrr

Sequence, based on observed residues (ATOM records): (download)

>d1z9wa_ d.96.1.3 (A:) 7,8-dihydroneopterin aldolase {Mycobacterium tuberculosis [TaxId: 1773]}
adrielrgltvhggqrfvidvtvwidlaeaansddladtydyvrlasraaeivagpprkl
ietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsrr

SCOPe Domain Coordinates for d1z9wa_:

Click to download the PDB-style file with coordinates for d1z9wa_.
(The format of our PDB-style files is described here.)

Timeline for d1z9wa_: