Lineage for d1z9ua_ (1z9u A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037211Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1037212Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1037712Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1037713Protein automated matches [190038] (8 species)
    not a true protein
  7. 1037723Species Salmonella typhimurium [TaxId:99287] [186758] (4 PDB entries)
  8. 1037730Domain d1z9ua_: 1z9u A: [124770]
    automated match to d1nsla_
    complexed with so4

Details for d1z9ua_

PDB Entry: 1z9u (more details), 2.2 Å

PDB Description: Structural Genomics, The crystal structure of the acetyl transferase, modifies N-terminal serine of 50S ribosomal subunit protein L7/L12 from Salmonella typhimurium
PDB Compounds: (A:) acetyl transferase

SCOPe Domain Sequences for d1z9ua_:

Sequence, based on SEQRES records: (download)

>d1z9ua_ d.108.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]}
eiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnillh
qrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthya
rrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariid

Sequence, based on observed residues (ATOM records): (download)

>d1z9ua_ d.108.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]}
eiipvsttlelraadeshvpalhqlvlknkawlqqsldqytsqeetrkhvqgnillhqrg
yakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmthyarrg
dirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariid

SCOPe Domain Coordinates for d1z9ua_:

Click to download the PDB-style file with coordinates for d1z9ua_.
(The format of our PDB-style files is described here.)

Timeline for d1z9ua_: