![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) ![]() |
![]() | Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins) |
![]() | Protein Caf1m [89221] (1 species) chaperone of F1 capsule antigen Caf1 |
![]() | Species Yersinia pestis [TaxId:632] [89222] (8 PDB entries) |
![]() | Domain d1z9sa2: 1z9s A:148-234 [124769] Other proteins in same PDB: d1z9sa1, d1z9sb1, d1z9sc_ automated match to d1p5ua2 |
PDB Entry: 1z9s (more details), 2.2 Å
SCOPe Domain Sequences for d1z9sa2:
Sequence, based on SEQRES records: (download)
>d1z9sa2 b.7.2.1 (A:148-234) Caf1m {Yersinia pestis [TaxId: 632]} kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg lagarnvswriindqggldrlysknvt
>d1z9sa2 b.7.2.1 (A:148-234) Caf1m {Yersinia pestis [TaxId: 632]} kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlarn vswriindqggldrlysknvt
Timeline for d1z9sa2: