SCOPe 2.02: Domain d1z9sa2: 1z9s A:148-234

Lineage for d1z9sa2 (1z9s A:148-234)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)

6. Protein Caf1m [89221] (1 species)
   chaperone of F1 capsule antigen Caf1

7. Species Yersinia pestis [TaxId:632] [89222] (4 PDB entries)

8. Domain d1z9sa2: 1z9s A:148-234 [124769]
   Other proteins in same PDB: d1z9sa1, d1z9sb1, d1z9sc_
   automatically matched to d1p5ua2

Details for d1z9sa2

PDB Entry: 1z9s, 2.2 Å

PDB Description: Crystal Structure of the native chaperone:subunit:subunit Caf1M:Caf1:Caf1 complex

PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d1z9sa2:

Sequence, based on SEQRES records:

>d1z9sa2 b.7.2.1 (A:148-234) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknvt

Sequence, based on observed residues (ATOM records):

>d1z9sa2 b.7.2.1 (A:148-234) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlarn
vswriindqggldrlysknvt

Timeline for d1z9sa2:

• d1z9sa2 first appeared in SCOP 1.73
  
• d1z9sa2 appears in SCOPe 2.01
  
• d1z9sa2 appears in SCOPe 2.03
  
• d1z9sa2 appears in the current release, SCOPe 2.08