Lineage for d1z9sa2 (1z9s A:148-234)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 941314Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 941463Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) (S)
  5. 941464Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 941465Protein Caf1m [89221] (1 species)
    chaperone of F1 capsule antigen Caf1
  7. 941466Species Yersinia pestis [TaxId:632] [89222] (4 PDB entries)
  8. 941469Domain d1z9sa2: 1z9s A:148-234 [124769]
    Other proteins in same PDB: d1z9sa1, d1z9sb1, d1z9sc_
    automatically matched to d1p5ua2

Details for d1z9sa2

PDB Entry: 1z9s (more details), 2.2 Å

PDB Description: Crystal Structure of the native chaperone:subunit:subunit Caf1M:Caf1:Caf1 complex
PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d1z9sa2:

Sequence, based on SEQRES records: (download)

>d1z9sa2 b.7.2.1 (A:148-234) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknvt

Sequence, based on observed residues (ATOM records): (download)

>d1z9sa2 b.7.2.1 (A:148-234) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlarn
vswriindqggldrlysknvt

SCOPe Domain Coordinates for d1z9sa2:

Click to download the PDB-style file with coordinates for d1z9sa2.
(The format of our PDB-style files is described here.)

Timeline for d1z9sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z9sa1