Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (2 families) contains PP switch between strands D and C' |
Family b.1.11.1: Pilus chaperone [49355] (5 proteins) |
Protein Chaperone protein Caf1m [89205] (1 species) |
Species Yersinia pestis [TaxId:632] [89206] (4 PDB entries) |
Domain d1z9sa1: 1z9s A:9-147 [124768] Other proteins in same PDB: d1z9sa2, d1z9sb1 automatically matched to d1p5va1 |
PDB Entry: 1z9s (more details), 2.2 Å
SCOP Domain Sequences for d1z9sa1:
Sequence, based on SEQRES records: (download)
>d1z9sa1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]} skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplf rldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdvgv fvqfainncikllvrpnel
>d1z9sa1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]} skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekpfvvtpplfrlda kqqnslriaqaggvfprdkeslkwlcvkgippdvgvfvqfainncikllvrpnel
Timeline for d1z9sa1: