SCOP 1.75: Domain d1z9sa1: 1z9s A:9-147

Lineage for d1z9sa1 (1z9s A:9-147)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (5 proteins)

6. Protein Chaperone protein Caf1m [89205] (1 species)

7. Species Yersinia pestis [TaxId:632] [89206] (4 PDB entries)

8. Domain d1z9sa1: 1z9s A:9-147 [124768]
   Other proteins in same PDB: d1z9sa2, d1z9sb1
   automatically matched to d1p5va1

Details for d1z9sa1

PDB Entry: 1z9s, 2.2 Å

PDB Description: Crystal Structure of the native chaperone:subunit:subunit Caf1M:Caf1:Caf1 complex

PDB Compounds: (A:) Chaperone protein Caf1M

SCOP Domain Sequences for d1z9sa1:

Sequence, based on SEQRES records:

>d1z9sa1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplf
rldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdvgv
fvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records):

>d1z9sa1 b.1.11.1 (A:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekpfvvtpplfrlda
kqqnslriaqaggvfprdkeslkwlcvkgippdvgvfvqfainncikllvrpnel

Timeline for d1z9sa1:

• d1z9sa1 first appeared in SCOP 1.73
  
• d1z9sa1 appears in SCOPe 2.01
  
• d1z9sa1 appears in the current release, SCOPe 2.08