SCOPe 2.07: Domain d1z9kb1: 1z9k B:1-302

Lineage for d1z9kb1 (1z9k B:1-302)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (64 PDB entries)
   Uniprot P02953

8. Domain d1z9kb1: 1z9k B:1-302 [124767]
   Other proteins in same PDB: d1z9ka1
   automatically matched to d2rcrm_
   complexed with bcl, bph, fe, mn, u10

Details for d1z9kb1

PDB Entry: 1z9k, 4.6 Å

PDB Description: Photosynthetic Reaction Center from Rhodobacter sphaeroides

PDB Compounds: (B:) reaction center protein m chain

SCOPe Domain Sequences for d1z9kb1:

Sequence; same for both SEQRES and ATOM records:

>d1z9kb1 f.26.1.1 (B:1-302) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d1z9kb1:

• d1z9kb1 first appeared in SCOP 1.73
  
• d1z9kb1 appears in SCOPe 2.06
  
• d1z9kb1 appears in the current release, SCOPe 2.08