Domain d1z9kb1: 1z9k B:1-302

Structural Classification of Proteins and ASTRAL release 1.73 (November 2007)

Lineage for d1z9kb1 (1z9k B:1-302)

Root: SCOP 1.73
Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
five transmembrane helices forming a sheet-like structure
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 protein domains)
L and M are probably related to each other
Protein M (medium) subunit [81481] (3 species)
Species Rhodobacter sphaeroides [TaxId:1063] [81479] (50 PDB entries)
Domain d1z9kb1: 1z9k B:1-302 [124767]
Other proteins in same PDB: d1z9ka1
automatically matched to d2rcrm_
complexed with bcl, bph, fe, mn, u10

Details for d1z9kb1

PDB Entry: 1z9k (more details)
PDB Description: photosynthetic reaction center from rhodobacter sphaeroides
PDB Compounds: (B:) reaction center protein m chain

SCOP Domain Sequences for d1z9kb1:
Sequence; same for both SEQRES and ATOM records: (download)

>d1z9kb1 f.26.1.1 (B:1-302) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]} aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn hg

SCOP Domain Coordinates for d1z9kb1:

Click to download the PDB-style file with coordinates for d1z9kb1.
(The format of our PDB-style files is described here.)

Timeline for d1z9kb1:
d1z9kb1 is new in SCOP 1.73
d1z9kb1 appears in SCOP 1.75

d1z9kb1
(click for larger image)

d1z9kb1 in context of chain

d1z9kb1 in context of PDB
Domains from other chains:
d1z9ka1