Structural Classification of Proteins and ASTRAL release 1.73 (November 2007)
Search SCOP (example):

Lineage for d1z9kb1 (1z9k B:1-302)

  1. Root: SCOP 1.73
  2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 protein domains)
    L and M are probably related to each other
  6. Protein M (medium) subunit [81481] (3 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (50 PDB entries)
  8. Domain d1z9kb1: 1z9k B:1-302 [124767]
    Other proteins in same PDB: d1z9ka1
    automatically matched to d2rcrm_
    complexed with bcl, bph, fe, mn, u10

Details for d1z9kb1

PDB Entry: 1z9k (more details)
PDB Description: photosynthetic reaction center from rhodobacter sphaeroides
PDB Compounds: (B:) reaction center protein m chain

SCOP Domain Sequences for d1z9kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z9kb1 f.26.1.1 (B:1-302) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOP Domain Coordinates for d1z9kb1:

Click to download the PDB-style file with coordinates for d1z9kb1.
(The format of our PDB-style files is described here.)

Timeline for d1z9kb1:

d1z9kb1 is new in SCOP 1.73
d1z9kb1 appears in SCOP 1.75


d1z9kb1
(click for larger image)


d1z9kb1 in context of chain



d1z9kb1 in context of PDB
Domains from other chains:
d1z9ka1


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu