![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein L (light) subunit [81477] (4 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81475] (68 PDB entries) Uniprot P02954 |
![]() | Domain d1z9ka1: 1z9k A:1-281 [124766] Other proteins in same PDB: d1z9kb1 automatically matched to d1aigl_ complexed with bcl, bph, fe, mn, u10 |
PDB Entry: 1z9k (more details), 4.6 Å
SCOPe Domain Sequences for d1z9ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z9ka1 f.26.1.1 (A:1-281) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d1z9ka1: