![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Microsomal prostaglandin E synthase-2 [140556] (1 species) |
![]() | Species Crab-eating macaque (Macaca fascicularis) [TaxId:9541] [140557] (2 PDB entries) Uniprot Q9N0A4 213-373 |
![]() | Domain d1z9hc1: 1z9h C:213-373 [124762] Other proteins in same PDB: d1z9ha2, d1z9hb2, d1z9hc2, d1z9hd2 automated match to d1z9ha1 complexed with act, cl, imn |
PDB Entry: 1z9h (more details), 2.6 Å
SCOPe Domain Sequences for d1z9hc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z9hc1 a.45.1.1 (C:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} lnekeaqqvysgkearteemkwrqwaddwlvhlispnvyrtptealasfdyivregkfga vegavakymgaaamyliskrlksrhrlqdnvredlyeaadkwvaavgkdrpfmggqkpnl adlavygvlrvmegldafddlmqhthiqpwylrveraitea
Timeline for d1z9hc1: