Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Microsomal prostaglandin E synthase-2 [142363] (1 species) |
Species Crab-eating macaque (Macaca fascicularis) [TaxId:9541] [142364] (2 PDB entries) Uniprot Q9N0A4 100-212 |
Domain d1z9hb2: 1z9h B:100-212 [124761] Other proteins in same PDB: d1z9ha1, d1z9hb1, d1z9hc1, d1z9hd1 automated match to d1z9ha2 complexed with act, cl, imn |
PDB Entry: 1z9h (more details), 2.6 Å
SCOPe Domain Sequences for d1z9hb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z9hb2 c.47.1.5 (B:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} lqltlyqyktcpfcskvrafldfhalpyqvvevnpvlraeikfssyrkvpilvaqegess qqlndssviisalktylvsgqpleeiityypamkavndqgkevtefgnkywlm
Timeline for d1z9hb2: