Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.3: PyrH-like [142721] (4 proteins) part of Pfam PF00696 |
Protein Uridylate kinase PyrH [142728] (6 species) |
Species Streptococcus pyogenes [TaxId:1314] [142729] (1 PDB entry) Uniprot P65938 2-239 |
Domain d1z9db_: 1z9d B: [124754] automated match to d1z9da1 complexed with so4 |
PDB Entry: 1z9d (more details), 2.8 Å
SCOPe Domain Sequences for d1z9db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z9db_ c.73.1.3 (B:) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} epkyqriliklsgealagekgvgidiptvqaiakeiaevhvsgvqialvigggnlwrgep aadagmdrvqadytgmlgtvmnalvmadslqhygvdtrvqtaipmqnvaepyirgralrh leknrivvfgagigspyfstdttaalraaeieadailmakngvdgvynadpkkdanavkf delthgevikrglkimdatastlsmdndidlvvfnmneagniqrvvfgehigttvsnk
Timeline for d1z9db_: