SCOPe 2.05: Domain d1z9db_: 1z9d B:

Lineage for d1z9db_ (1z9d B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.3: PyrH-like [142721] (4 proteins)
   part of Pfam PF00696

6. Protein Uridylate kinase PyrH [142728] (6 species)

7. Species Streptococcus pyogenes [TaxId:1314] [142729] (1 PDB entry)
   Uniprot P65938 2-239

8. Domain d1z9db_: 1z9d B: [124754]
   automated match to d1z9da1
   complexed with so4

Details for d1z9db_

PDB Entry: 1z9d, 2.8 Å

PDB Description: crystal structure of a putative uridylate kinase (ump-kinase) from streptococcus pyogenes

PDB Compounds: (B:) uridylate kinase

SCOPe Domain Sequences for d1z9db_:

Sequence; same for both SEQRES and ATOM records:

>d1z9db_ c.73.1.3 (B:) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]}
epkyqriliklsgealagekgvgidiptvqaiakeiaevhvsgvqialvigggnlwrgep
aadagmdrvqadytgmlgtvmnalvmadslqhygvdtrvqtaipmqnvaepyirgralrh
leknrivvfgagigspyfstdttaalraaeieadailmakngvdgvynadpkkdanavkf
delthgevikrglkimdatastlsmdndidlvvfnmneagniqrvvfgehigttvsnk

Timeline for d1z9db_:

• d1z9db_ first appeared in SCOP 1.73, called d1z9db1
  
• d1z9db_ appears in SCOPe 2.04
  
• d1z9db_ appears in SCOPe 2.06
  
• d1z9db_ appears in the current release, SCOPe 2.08