SCOP 1.73: Domain d1z9db1: 1z9d B:4-241

Lineage for d1z9db1 (1z9d B:4-241)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (3 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.3: PyrH-like [142721] (3 proteins)
   part of Pfam PF00696

6. Protein Uridylate kinase PyrH [142728] (6 species)

7. Species Streptococcus pyogenes [TaxId:1314] [142729] (1 PDB entry)

8. Domain d1z9db1: 1z9d B:4-241 [124754]
   automatically matched to 1Z9D A:4-241
   complexed with so4

Details for d1z9db1

PDB Entry: 1z9d, 2.8 Å

PDB Description: crystal structure of a putative uridylate kinase (ump-kinase) from streptococcus pyogenes

PDB Compounds: (B:) uridylate kinase

SCOP Domain Sequences for d1z9db1:

Sequence; same for both SEQRES and ATOM records:

>d1z9db1 c.73.1.3 (B:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]}
epkyqriliklsgealagekgvgidiptvqaiakeiaevhvsgvqialvigggnlwrgep
aadagmdrvqadytgmlgtvmnalvmadslqhygvdtrvqtaipmqnvaepyirgralrh
leknrivvfgagigspyfstdttaalraaeieadailmakngvdgvynadpkkdanavkf
delthgevikrglkimdatastlsmdndidlvvfnmneagniqrvvfgehigttvsnk

Timeline for d1z9db1:

• d1z9db1 is new in SCOP 1.73
  
• d1z9db1 appears in SCOP 1.75
  
• d1z9db1 appears in the current release, SCOPe 2.08, called d1z9db_