Lineage for d1z9db_ (1z9d B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905205Family c.73.1.3: PyrH-like [142721] (4 proteins)
    part of Pfam PF00696
  6. 2905225Protein Uridylate kinase PyrH [142728] (6 species)
  7. 2905244Species Streptococcus pyogenes [TaxId:1314] [142729] (1 PDB entry)
    Uniprot P65938 2-239
  8. 2905246Domain d1z9db_: 1z9d B: [124754]
    automated match to d1z9da1
    complexed with so4

Details for d1z9db_

PDB Entry: 1z9d (more details), 2.8 Å

PDB Description: crystal structure of a putative uridylate kinase (ump-kinase) from streptococcus pyogenes
PDB Compounds: (B:) uridylate kinase

SCOPe Domain Sequences for d1z9db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z9db_ c.73.1.3 (B:) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]}
epkyqriliklsgealagekgvgidiptvqaiakeiaevhvsgvqialvigggnlwrgep
aadagmdrvqadytgmlgtvmnalvmadslqhygvdtrvqtaipmqnvaepyirgralrh
leknrivvfgagigspyfstdttaalraaeieadailmakngvdgvynadpkkdanavkf
delthgevikrglkimdatastlsmdndidlvvfnmneagniqrvvfgehigttvsnk

SCOPe Domain Coordinates for d1z9db_:

Click to download the PDB-style file with coordinates for d1z9db_.
(The format of our PDB-style files is described here.)

Timeline for d1z9db_: