Lineage for d1z9da1 (1z9d A:4-241)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708177Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 708178Superfamily c.73.1: Carbamate kinase-like [53633] (3 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 708221Family c.73.1.3: PyrH-like [142721] (3 proteins)
    part of Pfam PF00696
  6. 708241Protein Uridylate kinase PyrH [142728] (6 species)
  7. 708270Species Streptococcus pyogenes [TaxId:1314] [142729] (1 PDB entry)
  8. 708271Domain d1z9da1: 1z9d A:4-241 [124753]
    complexed with so4

Details for d1z9da1

PDB Entry: 1z9d (more details), 2.8 Å

PDB Description: crystal structure of a putative uridylate kinase (ump-kinase) from streptococcus pyogenes
PDB Compounds: (A:) uridylate kinase

SCOP Domain Sequences for d1z9da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]}
epkyqriliklsgealagekgvgidiptvqaiakeiaevhvsgvqialvigggnlwrgep
aadagmdrvqadytgmlgtvmnalvmadslqhygvdtrvqtaipmqnvaepyirgralrh
leknrivvfgagigspyfstdttaalraaeieadailmakngvdgvynadpkkdanavkf
delthgevikrglkimdatastlsmdndidlvvfnmneagniqrvvfgehigttvsnk

SCOP Domain Coordinates for d1z9da1:

Click to download the PDB-style file with coordinates for d1z9da1.
(The format of our PDB-style files is described here.)

Timeline for d1z9da1: