Lineage for d1z99a_ (1z99 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637642Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 2637643Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 2637781Family g.9.1.2: Myotoxin [90157] (1 protein)
    structurally similar to beta-defensin
    automatically mapped to Pfam PF00819
  6. 2637782Protein Crotamine [90158] (1 species)
  7. 2637783Species South american rattlesnake (Crotalus durissus terrificus) [TaxId:8732] [90159] (3 PDB entries)
  8. 2637788Domain d1z99a_: 1z99 A: [124746]
    automated match to d4gv5a_

Details for d1z99a_

PDB Entry: 1z99 (more details)

PDB Description: solution structure of crotamine, a myotoxin from crotalus durissus terrificus
PDB Compounds: (A:) Crotamine

SCOPe Domain Sequences for d1z99a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z99a_ g.9.1.2 (A:) Crotamine {South american rattlesnake (Crotalus durissus terrificus) [TaxId: 8732]}
ykqchkkgghcfpkekiclppssdfgkmdcrwrwkcckkgsg

SCOPe Domain Coordinates for d1z99a_:

Click to download the PDB-style file with coordinates for d1z99a_.
(The format of our PDB-style files is described here.)

Timeline for d1z99a_: