Lineage for d1z94a1 (1z94 A:2-144)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2215131Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
    Pfam PF05146
  6. 2215147Protein Hypothetical protein CV1439 [143835] (1 species)
  7. 2215148Species Chromobacterium violaceum [TaxId:536] [143836] (1 PDB entry)
    Uniprot Q7NY36 2-144
  8. 2215149Domain d1z94a1: 1z94 A:2-144 [124740]

Details for d1z94a1

PDB Entry: 1z94 (more details), 2.1 Å

PDB Description: X-Ray Crystal Structure of Protein CV1439 from Chromobacterium violaceum. Northeast Structural Genomics Consortium Target CvR12.
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1z94a1:

Sequence, based on SEQRES records: (download)

>d1z94a1 d.129.3.5 (A:2-144) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]}
pntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafas
gqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipdai
ppencylgwqqslkqlaalvepd

Sequence, based on observed residues (ATOM records): (download)

>d1z94a1 d.129.3.5 (A:2-144) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]}
pntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafas
gqkhafggrylelvpgerirytdrfddagdmittitlaplscgadlsivqegipdaippe
ncylgwqqslkqlaalvepd

SCOPe Domain Coordinates for d1z94a1:

Click to download the PDB-style file with coordinates for d1z94a1.
(The format of our PDB-style files is described here.)

Timeline for d1z94a1: