Lineage for d1z8yt1 (1z8y T:114-264)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066379Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2066435Protein Viral capsid protein [50597] (3 species)
  7. 2066442Species Sindbis virus [TaxId:11034] [50598] (11 PDB entries)
  8. 2066461Domain d1z8yt1: 1z8y T:114-264 [124731]
    automatically matched to d1kxf__

Details for d1z8yt1

PDB Entry: 1z8y (more details), 9 Å

PDB Description: mapping the e2 glycoprotein of alphaviruses
PDB Compounds: (T:) capsid protein c

SCOPe Domain Sequences for d1z8yt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8yt1 b.47.1.3 (T:114-264) Viral capsid protein {Sindbis virus [TaxId: 11034]}
rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
adegtrtalsvvtwnskgktikttpegteew

SCOPe Domain Coordinates for d1z8yt1:

Click to download the PDB-style file with coordinates for d1z8yt1.
(The format of our PDB-style files is described here.)

Timeline for d1z8yt1: