SCOP 1.75: Domain d1z8ua1: 1z8u A:2-91

Lineage for d1z8ua1 (1z8u A:2-91)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.11: Alpha-hemoglobin stabilizing protein AHSP [109751] (1 family)
   the bundle twist angle is close to zero (small positive value); similar to the RRF alpha-helical bundle, (55194)

5. Family a.7.11.1: Alpha-hemoglobin stabilizing protein AHSP [109752] (1 protein)
   this is a repeat family; one repeat unit is 1w0a A: found in domain

6. Protein Alpha-hemoglobin stabilizing protein AHSP [109753] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109754] (6 PDB entries)
   Uniprot Q9NZD4 1-94

8. Domain d1z8ua1: 1z8u A:2-91 [124724]
   Other proteins in same PDB: d1z8ub1, d1z8ud1
   automatically matched to d1w0ba_
   complexed with hem; mutant

Details for d1z8ua1

PDB Entry: 1z8u, 2.4 Å

PDB Description: crystal structure of oxidized alpha hemoglobin bound to ahsp

PDB Compounds: (A:) alpha-hemoglobin stabilizing protein

SCOP Domain Sequences for d1z8ua1:

Sequence; same for both SEQRES and ATOM records:

>d1z8ua1 a.7.11.1 (A:2-91) Alpha-hemoglobin stabilizing protein AHSP {Human (Homo sapiens) [TaxId: 9606]}
allkankdlisaglkefsvllnqqvfndalvseedmvtvvedwmnfyinyyrqqvtgepq
erdkalqelrqelntlanpflakyrdflks

Timeline for d1z8ua1:

• d1z8ua1 first appeared in SCOP 1.73
  
• d1z8ua1 appears in SCOPe 2.01
  
• d1z8ua1 appears in the current release, SCOPe 2.08, called d1z8ua_