Lineage for d1z8pa_ (1z8p A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. Protein Cytochrome P450-ERYF [48272] (1 species)
  7. Species Saccharopolyspora erythraea [TaxId:1836] [48273] (10 PDB entries)
  8. Domain d1z8pa_: 1z8p A: [124723]
    automated match to d1jioa_
    complexed with deb, hem, oxy

Details for d1z8pa_

PDB Entry: 1z8p (more details), 1.85 Å

PDB Description: Ferrous dioxygen complex of the A245S cytochrome P450eryF
PDB Compounds: (A:) 6-deoxyerythronolide B hydroxylase

SCOPe Domain Sequences for d1z8pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8pa_ a.104.1.1 (A:) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]}
ttvpdlesdsfhvdwyrtyaelretapvtpvrflgqdawlvtgydeakaalsdlrlssdp
kkkypgvevefpaylgfpedvrnyfatnmgtsdppthtrlrklvsqeftvrrveamrprv
eqitaelldevgdsgvvdivdrfahplpikvicellgvdekyrgefgrwsseilvmdper
aeqrgqaarevvnfildlverrrtepgddllsalirvqddddgrlsadeltsialvllla
gfessvsligigtylllthpdqlalvrrdpsalpnaveeilryiappetttrfaaeevei
ggvaipqystvlvangaanrdpkqfpdphrfdvtrdtrghlsfgqgihfcmgrplakleg
evalralfgrfpalslgidaddvvwrrslllrgidhlpvrldg

SCOPe Domain Coordinates for d1z8pa_ are not available.

Timeline for d1z8pa_: