Lineage for d1z8na3 (1z8n A:460-667)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2864860Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 2864861Protein Acetohydroxyacid synthase catalytic subunit [88758] (3 species)
  7. 2864890Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142208] (12 PDB entries)
    Uniprot P17597 460-667
  8. 2864896Domain d1z8na3: 1z8n A:460-667 [124721]
    Other proteins in same PDB: d1z8na1, d1z8na2
    automated match to d1ybha3
    complexed with 1iq, fad, mg, nhe, tpp

Details for d1z8na3

PDB Entry: 1z8n (more details), 2.8 Å

PDB Description: Crystal structure of Arabidopsis thaliana Acetohydroxyacid synthase In Complex With An Imidazolinone Herbicide, Imazaquin
PDB Compounds: (A:) Acetolactate synthase

SCOPe Domain Sequences for d1z8na3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8na3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
eaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwlssgglgamgfglpa
aigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnnqhlgmvmqwedrfy
kanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreaiqtmldtpgpylldv
icphqehvlpmipsggtfndvitegdgr

SCOPe Domain Coordinates for d1z8na3:

Click to download the PDB-style file with coordinates for d1z8na3.
(The format of our PDB-style files is described here.)

Timeline for d1z8na3: