Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.298: RelE-like [143010] (1 superfamily) beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432 |
Superfamily d.298.1: RelE-like [143011] (2 families) Toxin component of plasmid stabilisation system |
Family d.298.1.2: RelE-like [143015] (2 proteins) Pfam PF05016 |
Protein Hypothetical protein HP0894 [143018] (1 species) |
Species Helicobacter pylori [TaxId:210] [143019] (1 PDB entry) Uniprot O25554 1-88 |
Domain d1z8ma1: 1z8m A:1-88 [124718] |
PDB Entry: 1z8m (more details)
SCOP Domain Sequences for d1z8ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z8ma1 d.298.1.2 (A:1-88) Hypothetical protein HP0894 {Helicobacter pylori [TaxId: 210]} mlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfrech ikpdvllvylvkddelillrlgshself
Timeline for d1z8ma1: