Class a: All alpha proteins [46456] (284 folds) |
Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) |
Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins) |
Protein Glutamate carboxypeptidase II [140574] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140575] (14 PDB entries) Uniprot Q04609 594-750 |
Domain d1z8ld1: 1z8l D:594-750 [124715] Other proteins in same PDB: d1z8la2, d1z8la3, d1z8lb2, d1z8lb3, d1z8lc2, d1z8lc3, d1z8ld2, d1z8ld3 automatically matched to 2C6C A:594-750 complexed with nag, ndg, zn |
PDB Entry: 1z8l (more details), 3.5 Å
SCOP Domain Sequences for d1z8ld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z8ld1 a.48.2.1 (D:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]} pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf dieskvdpskawgevkrqiyvaaftvqaaaetlseva
Timeline for d1z8ld1: