Lineage for d1z8ld1 (1z8l D:594-750)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770413Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 770432Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) (S)
  5. 770433Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)
  6. 770434Protein Glutamate carboxypeptidase II [140574] (1 species)
  7. 770435Species Human (Homo sapiens) [TaxId:9606] [140575] (14 PDB entries)
    Uniprot Q04609 594-750
  8. 770452Domain d1z8ld1: 1z8l D:594-750 [124715]
    Other proteins in same PDB: d1z8la2, d1z8la3, d1z8lb2, d1z8lb3, d1z8lc2, d1z8lc3, d1z8ld2, d1z8ld3
    automatically matched to 2C6C A:594-750
    complexed with nag, ndg, zn

Details for d1z8ld1

PDB Entry: 1z8l (more details), 3.5 Å

PDB Description: crystal structure of prostate-specific membrane antigen, a tumor marker and peptidase
PDB Compounds: (D:) glutamate carboxypeptidase II

SCOP Domain Sequences for d1z8ld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8ld1 a.48.2.1 (D:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf
dieskvdpskawgevkrqiyvaaftvqaaaetlseva

SCOP Domain Coordinates for d1z8ld1:

Click to download the PDB-style file with coordinates for d1z8ld1.
(The format of our PDB-style files is described here.)

Timeline for d1z8ld1: