![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.4: PA domain [52025] (1 family) ![]() |
![]() | Family c.8.4.1: PA domain [52026] (2 proteins) |
![]() | Protein Glutamate carboxypeptidase II [141984] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141985] (11 PDB entries) |
![]() | Domain d1z8lb2: 1z8l B:118-350 [124710] Other proteins in same PDB: d1z8la1, d1z8la3, d1z8lb1, d1z8lb3, d1z8lc1, d1z8lc3, d1z8ld1, d1z8ld3 automatically matched to 2C6C A:118-350 complexed with nag, ndg, zn |
PDB Entry: 1z8l (more details), 3.5 Å
SCOP Domain Sequences for d1z8lb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z8lb2 c.8.4.1 (B:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]} sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi gyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstn
Timeline for d1z8lb2: