Class b: All beta proteins [48724] (165 folds) |
Fold b.159: Allene oxide cyclase-like [141492] (1 superfamily) barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds |
Superfamily b.159.1: Allene oxide cyclase-like [141493] (1 family) |
Family b.159.1.1: Allene oxide cyclase-like [141494] (1 protein) Pfam PF06351 |
Protein Allene oxide cyclase, AOC [141495] (2 species) |
Species Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId:3702] [141496] (2 PDB entries) |
Domain d1z8kc1: 1z8k C:20-193 [124705] automatically matched to 1Z8K A:20-193 |
PDB Entry: 1z8k (more details), 1.71 Å
SCOP Domain Sequences for d1z8kc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z8kc1 b.159.1.1 (C:20-193) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702]} kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
Timeline for d1z8kc1: