Lineage for d1z8hc1 (1z8h C:6-205)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692305Superfamily c.23.10: SGNH hydrolase [52266] (7 families) (S)
  5. 692358Family c.23.10.6: Hypothetical protein alr1529 [102240] (1 protein)
  6. 692359Protein Hypothetical protein alr1529 [102241] (1 species)
    putative lipase
  7. 692360Species Nostoc sp. pcc 7120 [TaxId:103690] [102242] (2 PDB entries)
  8. 692363Domain d1z8hc1: 1z8h C:6-205 [124701]
    automatically matched to d1vjga_
    complexed with ipa, unl

Details for d1z8hc1

PDB Entry: 1z8h (more details), 2.02 Å

PDB Description: crystal structure of a gdsl-like lipase (alr1529) from nostoc sp. pcc 7120 at 2.02 a resolution
PDB Compounds: (C:) putative lipase from the G-D-S-L family

SCOP Domain Sequences for d1z8hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8hc1 c.23.10.6 (C:6-205) Hypothetical protein alr1529 {Nostoc sp. pcc 7120 [TaxId: 103690]}
ktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyynlgirrdtssdiakrwl
qevslrlhkeynslvvfsfglndttlengkprvsiaetikntreiltqakklypvlmisp
apyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekpsvwlheakandgvhpqa
ggytefarivenwdawlnwf

SCOP Domain Coordinates for d1z8hc1:

Click to download the PDB-style file with coordinates for d1z8hc1.
(The format of our PDB-style files is described here.)

Timeline for d1z8hc1: