Lineage for d1z8hb_ (1z8h B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465640Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2465719Family c.23.10.6: Hypothetical protein alr1529 [102240] (1 protein)
    automatically mapped to Pfam PF13472
    automatically mapped to Pfam PF00657
  6. 2465720Protein Hypothetical protein alr1529 [102241] (1 species)
    putative lipase
  7. 2465721Species Nostoc sp. PCC 7120 [TaxId:103690] [102242] (2 PDB entries)
  8. 2465723Domain d1z8hb_: 1z8h B: [124700]
    automated match to d1vjga_
    complexed with ipa, unl

Details for d1z8hb_

PDB Entry: 1z8h (more details), 2.02 Å

PDB Description: crystal structure of a gdsl-like lipase (alr1529) from nostoc sp. pcc 7120 at 2.02 a resolution
PDB Compounds: (B:) putative lipase from the G-D-S-L family

SCOPe Domain Sequences for d1z8hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8hb_ c.23.10.6 (B:) Hypothetical protein alr1529 {Nostoc sp. PCC 7120 [TaxId: 103690]}
tqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyynlgirrdtssdiakrwlq
evslrlhkeynslvvfsfglndttlengkprvsiaetikntreiltqakklypvlmispa
pyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekpsvwlheakandgvhpqag
gytefarivenwdawlnwf

SCOPe Domain Coordinates for d1z8hb_:

Click to download the PDB-style file with coordinates for d1z8hb_.
(The format of our PDB-style files is described here.)

Timeline for d1z8hb_: