SCOP 1.73: Domain d1z8hb1: 1z8h B:7-205

Lineage for d1z8hb1 (1z8h B:7-205)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (7 families)

5. Family c.23.10.6: Hypothetical protein alr1529 [102240] (1 protein)

6. Protein Hypothetical protein alr1529 [102241] (1 species)
   putative lipase

7. Species Nostoc sp. pcc 7120 [TaxId:103690] [102242] (2 PDB entries)

8. Domain d1z8hb1: 1z8h B:7-205 [124700]
   automatically matched to d1vjga_
   complexed with ipa, unl

Details for d1z8hb1

PDB Entry: 1z8h, 2.02 Å

PDB Description: crystal structure of a gdsl-like lipase (alr1529) from nostoc sp. pcc 7120 at 2.02 a resolution

PDB Compounds: (B:) putative lipase from the G-D-S-L family

SCOP Domain Sequences for d1z8hb1:

Sequence; same for both SEQRES and ATOM records:

>d1z8hb1 c.23.10.6 (B:7-205) Hypothetical protein alr1529 {Nostoc sp. pcc 7120 [TaxId: 103690]}
tqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyynlgirrdtssdiakrwlq
evslrlhkeynslvvfsfglndttlengkprvsiaetikntreiltqakklypvlmispa
pyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekpsvwlheakandgvhpqag
gytefarivenwdawlnwf

Timeline for d1z8hb1:

• d1z8hb1 is new in SCOP 1.73
  
• d1z8hb1 appears in SCOP 1.75
  
• d1z8hb1 appears in the current release, SCOPe 2.08, called d1z8hb_