Lineage for d1z8ha_ (1z8h A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857457Family c.23.10.6: Hypothetical protein alr1529 [102240] (1 protein)
    automatically mapped to Pfam PF13472
    automatically mapped to Pfam PF00657
  6. 2857458Protein Hypothetical protein alr1529 [102241] (1 species)
    putative lipase
  7. 2857459Species Nostoc sp. PCC 7120 [TaxId:103690] [102242] (2 PDB entries)
  8. 2857460Domain d1z8ha_: 1z8h A: [124699]
    automated match to d1vjga_
    complexed with ipa, unl

Details for d1z8ha_

PDB Entry: 1z8h (more details), 2.02 Å

PDB Description: crystal structure of a gdsl-like lipase (alr1529) from nostoc sp. pcc 7120 at 2.02 a resolution
PDB Compounds: (A:) putative lipase from the G-D-S-L family

SCOPe Domain Sequences for d1z8ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8ha_ c.23.10.6 (A:) Hypothetical protein alr1529 {Nostoc sp. PCC 7120 [TaxId: 103690]}
sktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyynlgirrdtssdiakrw
lqevslrlhkeynslvvfsfglndttlengkprvsiaetikntreiltqakklypvlmis
papyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekpsvwlheakandgvhpq
aggytefarivenwdawlnwfr

SCOPe Domain Coordinates for d1z8ha_:

Click to download the PDB-style file with coordinates for d1z8ha_.
(The format of our PDB-style files is described here.)

Timeline for d1z8ha_: