Lineage for d1z8ga1 (1z8g A:163-417)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2065112Protein Hepsin, catalytic domain [101813] (1 species)
  7. 2065113Species Human (Homo sapiens) [TaxId:9606] [101814] (4 PDB entries)
    Uniprot P05981 163-417
  8. 2065114Domain d1z8ga1: 1z8g A:163-417 [124697]
    Other proteins in same PDB: d1z8ga2
    automatically matched to d1o5eh_

Details for d1z8ga1

PDB Entry: 1z8g (more details), 1.55 Å

PDB Description: crystal structure of the extracellular region of the transmembrane serine protease hepsin with covalently bound preferred substrate.
PDB Compounds: (A:) Serine protease hepsin

SCOPe Domain Sequences for d1z8ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav
aqasphglqlgvqavvyhggylpfrdpnseensndialvhlssplplteyiqpvclpaag
qalvdgkictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagyp
eggidacqgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifq
aikthseasgmvtql

SCOPe Domain Coordinates for d1z8ga1:

Click to download the PDB-style file with coordinates for d1z8ga1.
(The format of our PDB-style files is described here.)

Timeline for d1z8ga1: