Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein) the insertion subdomain is a helical hairpin automatically mapped to Pfam PF03767 |
Protein Class B acid phosphatase, AphA [102308] (2 species) |
Species Salmonella typhimurium [TaxId:90371] [142153] (4 PDB entries) Uniprot P58683 30-237 |
Domain d1z88d_: 1z88 D: [124694] automated match to d1rm7a_ complexed with mg; mutant |
PDB Entry: 1z88 (more details), 2.1 Å
SCOPe Domain Sequences for d1z88d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z88d_ c.108.1.12 (D:) Class B acid phosphatase, AphA {Salmonella typhimurium [TaxId: 90371]} spstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkk tyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktet vsktladnfhipaanmnpvifagdkpeqntrvqwlqeknmrifygdsdnditaardcgir girilraanstykplpqagafgeevivnsey
Timeline for d1z88d_: