Lineage for d1z88c_ (1z88 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883628Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
    automatically mapped to Pfam PF03767
  6. 1883629Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 1883653Species Salmonella typhimurium [TaxId:90371] [142153] (4 PDB entries)
    Uniprot P58683 30-237
  8. 1883660Domain d1z88c_: 1z88 C: [124693]
    automated match to d1rm7a_
    complexed with mg; mutant

Details for d1z88c_

PDB Entry: 1z88 (more details), 2.1 Å

PDB Description: crystal structure of lys154arg mutant of mature apha of s. typhimurium
PDB Compounds: (C:) AphA protein

SCOPe Domain Sequences for d1z88c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z88c_ c.108.1.12 (C:) Class B acid phosphatase, AphA {Salmonella typhimurium [TaxId: 90371]}
stlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkty
spdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvs
ktladnfhipaanmnpvifagdkpeqntrvqwlqeknmrifygdsdnditaardcgirgi
rilraanstykplpqagafgeevivnsey

SCOPe Domain Coordinates for d1z88c_:

Click to download the PDB-style file with coordinates for d1z88c_.
(The format of our PDB-style files is described here.)

Timeline for d1z88c_: