![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
![]() | Protein automated matches [190055] (6 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [189198] (6 PDB entries) |
![]() | Domain d1z86a_: 1z86 A: [124690] automated match to d1qava_ |
PDB Entry: 1z86 (more details)
SCOPe Domain Sequences for d1z86a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z86a_ b.36.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rrrvtvrkadagglgisikggrenkmpiliskifkglaadqtealfvgdailsvngedls sathdeavqalkktgkevvlevkymke
Timeline for d1z86a_: