Lineage for d1z86a1 (1z86 A:79-164)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666575Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 666816Protein Syntrophin [50164] (1 species)
  7. 666817Species Mouse (Mus musculus) [TaxId:10090] [50165] (3 PDB entries)
  8. 666820Domain d1z86a1: 1z86 A:79-164 [124690]
    automatically matched to d1qava_

Details for d1z86a1

PDB Entry: 1z86 (more details)

PDB Description: Solution structure of the PDZ domain of alpha-syntrophin
PDB Compounds: (A:) Alpha-1-syntrophin

SCOP Domain Sequences for d1z86a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z86a1 b.36.1.1 (A:79-164) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]}
rrrvtvrkadagglgisikggrenkmpiliskifkglaadqtealfvgdailsvngedls
sathdeavqalkktgkevvlevkymk

SCOP Domain Coordinates for d1z86a1:

Click to download the PDB-style file with coordinates for d1z86a1.
(The format of our PDB-style files is described here.)

Timeline for d1z86a1: