Lineage for d1z86a_ (1z86 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786234Protein automated matches [190055] (6 species)
    not a true protein
  7. 2786344Species Mouse (Mus musculus) [TaxId:10090] [189198] (6 PDB entries)
  8. 2786358Domain d1z86a_: 1z86 A: [124690]
    automated match to d1qava_

Details for d1z86a_

PDB Entry: 1z86 (more details)

PDB Description: solution structure of the pdz domain of alpha-syntrophin
PDB Compounds: (A:) Alpha-1-syntrophin

SCOPe Domain Sequences for d1z86a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z86a_ b.36.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rrrvtvrkadagglgisikggrenkmpiliskifkglaadqtealfvgdailsvngedls
sathdeavqalkktgkevvlevkymke

SCOPe Domain Coordinates for d1z86a_:

Click to download the PDB-style file with coordinates for d1z86a_.
(The format of our PDB-style files is described here.)

Timeline for d1z86a_: