Lineage for d1z7zi4 (1z7z I:188-282)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 787055Family b.1.1.4: I set domains [49159] (38 proteins)
  6. 787253Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species)
  7. 787254Species Human (Homo sapiens) [TaxId:9606] [49163] (7 PDB entries)
  8. 787263Domain d1z7zi4: 1z7z I:188-282 [124683]
    Other proteins in same PDB: d1z7zi1, d1z7zi2
    automatically matched to d1p53a2
    complexed with nag, ndg; mutant

Details for d1z7zi4

PDB Entry: 1z7z (more details), 8 Å

PDB Description: cryo-em structure of human coxsackievirus a21 complexed with five domain icam-1kilifi
PDB Compounds: (I:) intercellular adhesion molecule-1

SCOP Domain Sequences for d1z7zi4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7zi4 b.1.1.4 (I:188-282) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]}
patppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygndsfsaka
svsvtaedegtqrltcavilgnqsqetlqtvtiys

SCOP Domain Coordinates for d1z7zi4:

Click to download the PDB-style file with coordinates for d1z7zi4.
(The format of our PDB-style files is described here.)

Timeline for d1z7zi4: