Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49163] (6 PDB entries) |
Domain d1z7zi4: 1z7z I:188-282 [124683] Other proteins in same PDB: d1z7zi1, d1z7zi2 automatically matched to d1p53a2 complexed with nag |
PDB Entry: 1z7z (more details), 8 Å
SCOPe Domain Sequences for d1z7zi4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7zi4 b.1.1.4 (I:188-282) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} patppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygndsfsaka svsvtaedegtqrltcavilgnqsqetlqtvtiys
Timeline for d1z7zi4:
View in 3D Domains from same chain: (mouse over for more information) d1z7zi1, d1z7zi2, d1z7zi3, d1z7zi5 |