Lineage for d1z7zi2 (1z7z I:283-366)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753466Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 2753531Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)
  7. 2753532Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries)
  8. 2753541Domain d1z7zi2: 1z7z I:283-366 [124681]
    Other proteins in same PDB: d1z7zi3, d1z7zi4, d1z7zi5
    automatically matched to d1p53a1
    complexed with nag

Details for d1z7zi2

PDB Entry: 1z7z (more details), 8 Å

PDB Description: cryo-em structure of human coxsackievirus a21 complexed with five domain icam-1kilifi
PDB Compounds: (I:) intercellular adhesion molecule-1

SCOPe Domain Sequences for d1z7zi2:

Sequence, based on SEQRES records: (download)

>d1z7zi2 b.1.1.3 (I:283-366) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fpapnviltkpevsegtevtvkceahprakvtlngvpaqplgpraqlllkatpedngrsf
scsatlevagqlihknqtrelrvl

Sequence, based on observed residues (ATOM records): (download)

>d1z7zi2 b.1.1.3 (I:283-366) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fpapnviltkpevsegtevtvkceagpraqlllkatpedngrsfscsatlevagqlihkn
qtrelrvl

SCOPe Domain Coordinates for d1z7zi2:

Click to download the PDB-style file with coordinates for d1z7zi2.
(The format of our PDB-style files is described here.)

Timeline for d1z7zi2: