Lineage for d1z7zi1 (1z7z I:83-187)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 786974Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 787032Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)
  7. 787033Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries)
  8. 787040Domain d1z7zi1: 1z7z I:83-187 [124680]
    Other proteins in same PDB: d1z7zi3, d1z7zi4, d1z7zi5
    automatically matched to d1ic1a1
    complexed with nag, ndg; mutant

Details for d1z7zi1

PDB Entry: 1z7z (more details), 8 Å

PDB Description: cryo-em structure of human coxsackievirus a21 complexed with five domain icam-1kilifi
PDB Compounds: (I:) intercellular adhesion molecule-1

SCOP Domain Sequences for d1z7zi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z7zi1 b.1.1.3 (I:83-187) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev
tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtfvl

SCOP Domain Coordinates for d1z7zi1:

Click to download the PDB-style file with coordinates for d1z7zi1.
(The format of our PDB-style files is described here.)

Timeline for d1z7zi1: