![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49146] (6 PDB entries) |
![]() | Domain d1z7zi1: 1z7z I:83-187 [124680] Other proteins in same PDB: d1z7zi3, d1z7zi4, d1z7zi5 automatically matched to d1ic1a1 complexed with nag, ndg; mutant |
PDB Entry: 1z7z (more details), 8 Å
SCOP Domain Sequences for d1z7zi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7zi1 b.1.1.3 (I:83-187) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtfvl
Timeline for d1z7zi1:
![]() Domains from same chain: (mouse over for more information) d1z7zi2, d1z7zi3, d1z7zi4, d1z7zi5 |